PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020691m
Common NameCARUB_v10020691mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 311aa    MW: 35441 Da    PI: 5.6304
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020691mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-163683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
  Carubv10020691m 36 RGPWSPEEDLKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYL 83
                     89******************************99************97 PP

2Myb_DNA-binding521.6e-1689134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+  ++++++ +G++ W++Ia+ ++ gRt++++k+ w+++l
  Carubv10020691m  89 RGNFTAEEEATIIKLHQNYGNK-WSKIASQLP-GRTDNEIKNVWHTHL 134
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-242786IPR009057Homeodomain-like
PROSITE profilePS5129415.4113183IPR017930Myb domain
SuperFamilySSF466896.34E-3034130IPR009057Homeodomain-like
SMARTSM007172.4E-133585IPR001005SANT/Myb domain
PfamPF002495.4E-153683IPR001005SANT/Myb domain
CDDcd001671.44E-93883No hitNo description
PROSITE profilePS5129425.87584138IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2887139IPR009057Homeodomain-like
SMARTSM007171.2E-1488136IPR001005SANT/Myb domain
PfamPF002493.4E-1589134IPR001005SANT/Myb domain
CDDcd001679.50E-1091134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MHHVDAKSNT ENRKRREGER MGKGRAPCCD KTKVKRGPWS PEEDLKLISF IQKFGHENWR  60
SLPKQSGLLR CGKSCRLRWI NYLRPDLKRG NFTAEEEATI IKLHQNYGNK WSKIASQLPG  120
RTDNEIKNVW HTHLKKRLVQ SSGTDHTADE PANSSPCSSD SVSRGEVSLN RTTRNALSTS  180
VSSGGSNHSI QEDDPKIGMT FEYIEEAYSD FNDIIQEVDK PDLLEIPFEP DPDIWSYLDA  240
SNSFQQSAAN EFSSASRPEE ESDEDEVKKW FKHLESELGL EDDDGQQQRT HDNKEESSSS  300
LLKNYELMIH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-25361384105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1753441e-152AK175344.1 Arabidopsis thaliana mRNA for putative transcription factor (MYB63), complete cds, clone: RAFL21-78-M22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302583.10.0hypothetical protein CARUB_v10020691mg
TrEMBLR0GID10.0R0GID1_9BRAS; Uncharacterized protein
STRINGAT1G79180.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-149myb domain protein 63